Latitude: 42.931852
Longitude: -71.4518339
Elevation: 46 meters / 151 feet
Barometric Pressure 1008KPa

Related Photos

Looking for inspiration, manchester photography streetphotography man photographer bench river bridge monochrome inspiration nikon lines view allyouneedislight
Looking for inspiration
View from the front window II., winter snow cold newengland newhampshire canondslr snowscene winterscene canon6d londonderrynewhampshire
View from the front window II.
Looking for beauty in the gray, river bridge drawins sun sky manchester newhampshire newengland merrimack
Looking for beauty in the gray
Big blue sky, blue sky barn farm horizon newengland newhampshire goffstown
Big blue sky
Macyellow, mcintyre ski area manchester new hampshire sky clouds horizon hills oak hill e hammer skiinian ianhammer ihamr
Macyellow
Great views…, fomba massabesiclake auburn nh ledge mtb view lake orange farley trek fatty fatbike hardtail
Great views…
Frog's Eye View,
Frog's Eye View
first NX image, night manchester fireworks newhampshire sigma1224mmf4556dg nikoncapturenx
first NX image
Mack's Apples, londonderrynewhampshire macksapples orchard summer apples appletrees
Mack's Apples
My favorite mistake, autumn fall leaves mistake naturesfinest d80 theperfectphotographer pmec
My favorite mistake
World News Tonight @ Amoskeag, amoskeag building buoyant dam gundersen lake livefreeordie manchester movie newhampshire nh night nightshots nikon places scenes shoreline shots town waterfront water hydro longexposure dark election catchycolors black rock stone d5000 river image picture interesting winter ice bobgundersen newengland blue white infrastructure orange yellow bridge landscape robertgundersen people buoy clear cold stonewall usa psnh photo nikond5000 reflection nikoncamera flickr vote eversourceenergy skyline outside outdoor generator electricity utility energy eversource hullstreetenergy ©bobgundersen dslr
World News Tonight @ Amoskeag
Rheostats, amoskeag building engine dam gundersen hydro lake machine manchester newhampshire nh nikon places shots waterfront water old black gears infrastructure d5000 image picture interesting historical bobgundersen newengland engineering brown white gold catchycolors robertgundersen usa psnh photo nikond5000 inside interior power nikoncamera flickr eversourceenergy powerplant powerstation indoor generator electricity utility energy eversource hullstreetenergy ©bobgundersen dslr
Rheostats
Bull, macro spring frog bullfrog d300 afsvrmicronikkor105mmf28gifed goldstaraward
Bull
Zimmerman House, camera autumn house detail brick motif architecture square lens manchester us october exterior newengland newhampshire places historic franklloydwright architect residence usonian fllw usonianhouse usonia currierartmuseum ef1635mmf28liiusm curriermuseum canoneos5dmarkiii archdaily ©hassanbagheri ©hbarchitectural
Zimmerman House
World News Tonight @ Amoskeag dam, amoskeag dam gundersen lake livefreeordie manchester movie newhampshire nh night nightshots nikon places scenes shoreline shots town waterfront water hydro longexposure dark election black rock stone d5000 river image picture interesting winter ice bobgundersen newengland landscape robertgundersen people buoyant usa psnh photo nikond5000 nikoncamera flickr vote eversourceenergy outside outdoor generator electricity utility energy eversource hullstreetenergy ©bobgundersen dslr
World News Tonight @ Amoskeag dam
Firewater, autumn abstract reflection fall nature water leaves d300 afsdxvrzoomnikkor18200mmf3556gifed aplusphoto colourartaward pmec
Firewater
Sunset over Uncanoonuc and MHT, sunset manchester airport mht manchesterboston regional londonderry new hampshire nh sky hammer skiinian ianhammer ihamr
Sunset over Uncanoonuc and MHT
3rd Floor..., red urban black sign yellow photoshop manchester concrete grey exposure industrial adobephotoshop parkinggarage garage parking gray newhampshire nh stairwell line stairway urbanart adobe exit curb manchesternh hdr highdynamicrange exitsign lightroom industrialart 3xp photomatix tonemapped adobelightroom tonemap threeexposures manchesternewhampshire hutdog83 flickrhutch joshhutchins
3rd Floor...
Macblu, mcintyre ski area manchester new hampshire sky clouds horizon hills oak hill hammer skiinian ianhammer ihamr
Macblu
Fireplace gas insert, Hearthstone Killington, fireplace fireplaceinsert
Fireplace gas insert, Hearthstone Killington
Manchester NH, summer panorama manchester evening newengland newhampshire rockrimmon
Manchester NH
What a Difference! (European Headlights), road old blue red usa white house abandoned barn lights mercedes benz us high closed peeling paint european view time market stuttgart farm rip vanity newhampshire plate grand nh headlights clean domestic german mercedesbenz era headlight miles awkward decrepit sleek derry manufactured bf109 rundown installed bf109e headlamps antiquated regulation marches gdm me109 july1990 bestcarever madeingermany islandpond w126 goneforever euroheadlights mandated 500sec grandviewfarm sealedbeam 560sec c126 southernnewhampshire tightwhips derryfleamarket absurdlaw
What a Difference! (European Headlights)
Manchester at Night, night manchester unitedstates newengland newhampshire clear
Manchester at Night
Fireplace insert ideas, fireplace fireplaceinsert
Fireplace insert ideas
Jotul Katahdin Gas Fireplace Picture, new autumn fireplace newengland burning your accessories manchesternh heating woodstove merrimacknh fireplaces keenenh vermontcastings woodstoves pelletstove gasfireplace stovewood hillsboroughnh bedfordnh fireplaceinsert gasfireplaces woodburningfireplace fireplaceinserts newenglandhome woodburningstoves gasstoves fireplacevillage allflame ventgasfireplace newhampshirefireplaces fireplaceventing homeheatingsolutions stoveswoodburning stovesnapoleonfireplacesfireplace constructionhome solutionsheat homefireplaces accessoriesfireplace jotulvermont chimneysinserts
Jotul Katahdin Gas Fireplace Picture
Not the worst view ever from a hotel room... New Hampshire Fisher Cats Ballpark, newhampshire
Not the worst view ever from a hotel room... New Hampshire Fisher Cats Ballpark
View of Manchester, NH from Millyard, manchester solar construction newhampshire nh electricity psnh
View of Manchester, NH from Millyard
Direct Vent Gas Fireplace Example, new autumn fireplace newengland burning your accessories manchesternh heating woodstove merrimacknh fireplaces keenenh vermontcastings woodstoves pelletstove gasfireplace stovewood hillsboroughnh bedfordnh fireplaceinsert gasfireplaces woodburningfireplace fireplaceinserts newenglandhome woodburningstoves gasstoves fireplacevillage allflame ventgasfireplace newhampshirefireplaces fireplaceventing homeheatingsolutions stoveswoodburning stovesnapoleonfireplacesfireplace constructionhome solutionsheat homefireplaces accessoriesfireplace jotulvermont chimneysinserts
Direct Vent Gas Fireplace Example
Snack, autumn fall nature newhampshire nh chipmunk blogged hancock d300 nhphototour aplusphoto afsvrzoomnikkor70300mmf4556gifed
Snack
Fireplace Insert Ideas, new autumn fireplace newengland burning your accessories manchesternh heating woodstove merrimacknh fireplaces keenenh vermontcastings woodstoves pelletstove gasfireplace stovewood hillsboroughnh bedfordnh fireplaceinsert gasfireplaces woodburningfireplace fireplaceinserts newenglandhome woodburningstoves gasstoves fireplacevillage allflame ventgasfireplace newhampshirefireplaces fireplaceventing homeheatingsolutions stoveswoodburning stovesnapoleonfireplacesfireplace constructionhome solutionsheat homefireplaces accessoriesfireplace jotulvermont chimneysinserts
Fireplace Insert Ideas
Napoleon Electric Fireplace, gasfireplace gasfireplaceinsert
Napoleon Electric Fireplace
Hearthstone Maidstone Gas Fireplace Insert, new autumn fireplace newengland burning your accessories manchesternh heating woodstove merrimacknh fireplaces keenenh vermontcastings pelletstove gasfireplace stovewood hillsboroughnh bedfordnh fireplaceinsert gasfireplaces fireplaceinserts newenglandhome newhampshirefireplaces fireplaceinsertfireplacevillagedisplays fireplaceventing homeheatingsolutions stoveswoodburning stovesnapoleonfireplacesfireplace constructionhome solutionsheat homefireplaces accessoriesfireplace jotulvermont chimneysinserts
Hearthstone Maidstone Gas Fireplace Insert
Vent Gas Fireplaces for Homes, new autumn fireplace newengland burning your accessories manchesternh heating woodstove merrimacknh fireplaces keenenh vermontcastings woodstoves pelletstove gasfireplace stovewood hillsboroughnh bedfordnh fireplaceinsert gasfireplaces woodburningfireplace fireplaceinserts newenglandhome woodburningstoves gasstoves fireplacevillage allflame ventgasfireplace newhampshirefireplaces fireplaceventing homeheatingsolutions stoveswoodburning stovesnapoleonfireplacesfireplace constructionhome solutionsheat homefireplaces accessoriesfireplace jotulvermont chimneysinserts
Vent Gas Fireplaces for Homes
Fireplace Village, Wood Stove, Fireplace Gas Insert, Fireplace Glass Door, fireplace woodstove gasstove fireplaceinsert fireplaceglassdoor
Fireplace Village, Wood Stove, Fireplace Gas Insert, Fireplace Glass Door
Vermont Castings Resolute wood stove, new autumn fireplace newengland newhampshire burning your accessories manchesternh heating woodstove merrimacknh fireplaces keenenh vermontcastings pelletstove gasfireplace stovewood hillsboroughnh bedfordnh fireplaceinsert gasfireplaces fireplaceinserts newenglandhome fireplacevillage newhampshirefireplacesfireplacevillagedisplays fireplaceventing homeheatingsolutions stoveswoodburning stovesnapoleonfireplacesfireplace constructionhome solutionsheat homefireplaces accessoriesfireplace jotulvermont chimneysinserts
Vermont Castings Resolute wood stove
Wood Burning Fire Place Insert, new autumn fireplace newengland burning your accessories manchesternh heating woodstove merrimacknh fireplaces keenenh vermontcastings woodstoves pelletstove gasfireplace stovewood hillsboroughnh bedfordnh fireplaceinsert gasfireplaces woodburningfireplace fireplaceinserts newenglandhome woodburningstoves gasstoves fireplacevillage allflame ventgasfireplace newhampshirefireplaces fireplaceventing homeheatingsolutions stoveswoodburning stovesnapoleonfireplacesfireplace constructionhome solutionsheat homefireplaces accessoriesfireplace jotulvermont chimneysinserts
Wood Burning Fire Place Insert
Heat & Glo Gas Fireplaces, new autumn fireplace newengland burning your accessories manchesternh heating woodstove merrimacknh fireplaces keenenh vermontcastings woodstoves pelletstove gasfireplace stovewood hillsboroughnh bedfordnh fireplaceinsert gasfireplaces woodburningfireplace fireplaceinserts newenglandhome woodburningstoves gasstoves fireplacevillage allflame ventgasfireplace newhampshirefireplaces heatglo fireplaceventing homeheatingsolutions stoveswoodburning stovesnapoleonfireplacesfireplace constructionhome solutionsheat homefireplaces accessoriesfireplace jotulvermont chimneysinserts
Heat & Glo Gas Fireplaces
Heat & Glo Grand XT Gas Fireplace Insert Photo, new autumn fireplace newengland burning your accessories manchesternh heating woodstove merrimacknh fireplaces keenenh vermontcastings pelletstove gasfireplace stovewood hillsboroughnh bedfordnh fireplaceinsert gasfireplaces fireplaceinserts newenglandhome newhampshirefireplaces fireplaceinsertfireplacevillagedisplays fireplaceventing homeheatingsolutions stoveswoodburning stovesnapoleonfireplacesfireplace constructionhome solutionsheat homefireplaces accessoriesfireplace jotulvermont chimneysinserts
Heat & Glo Grand XT Gas Fireplace Insert Photo
Howard Jones, newhampshire londonderry dagmar howardjones tupelomusichall
Howard Jones
Jotul Oslo Wood Stove, new autumn fireplace newengland burning your accessories manchesternh heating woodstove merrimacknh fireplaces keenenh vermontcastings woodstoves pelletstove gasfireplace stovewood jotul hillsboroughnh bedfordnh fireplaceinsert gasfireplaces woodburningfireplace fireplaceinserts newenglandhome woodburningstoves gasstoves fireplacevillage allflame ventgasfireplace newhampshirefireplaces fireplaceventing homeheatingsolutions stoveswoodburning stovesnapoleonfireplacesfireplace constructionhome solutionsheat homefireplaces accessoriesfireplace jotulvermont chimneysinserts
Jotul Oslo Wood Stove
Clydesdale Fireplace Insert, fireplace fireplaceinsert
Clydesdale Fireplace Insert
View from Amoskeag Hydro Dam, amoskeaghydro dam electricity manchester merrimackriver nh psnh powerplant amoskeag infrastructure newhampshire hydroelectric publicserviceofnewhampshire renewable energy generation eversourceenergy hullstreetenergy
View from Amoskeag Hydro Dam
Antheraea polyphemus, brown night moth casio exilim antheraeapolyphemus exs600
Antheraea polyphemus
Gas Fireplace Insert Photos, new autumn fireplace newengland burning your accessories manchesternh heating woodstove merrimacknh fireplaces keenenh vermontcastings woodstoves pelletstove gasfireplace stovewood hillsboroughnh bedfordnh fireplaceinsert gasfireplaces fireplaceinserts newenglandhome fireplaceaccessories fireplacevillage newhampshirefireplaces fireplacevillagedisplays fireplaceventing homeheatingsolutions stoveswoodburning stovesnapoleonfireplacesfireplace constructionhome solutionsheat homefireplaces accessoriesfireplace jotulvermont chimneysinserts
Gas Fireplace Insert Photos
BSG on my iPodVideo!, macro apple video technology ipod tech super scifi fi supermacro technologies sci battlestar galactica battlestargalactica bsg ipodvideo scoreme28
BSG on my iPodVideo!
Clouds on a cold and windy day., weatherphotos weatherphotography
Clouds on a cold and windy day.
Twin Bridges Park, winter water newhampshire merrimack twinbridgespark
Twin Bridges Park
Concrete shelter, bridge bw monochrome photography thunder gray manchester river concrete shelter rain clouds downtown weather lines architecture blackwhitephotos columns nikon d5100 tokina longexposure heavy structure notredame landscape urban city life
Concrete shelter
Beaver Pond Winter Dusk, blue winter sunset color ice fire dusk
Beaver Pond Winter Dusk
More Storms Heading In, travel trees sky tree nature colors beautiful weather rural forest sunrise landscape landscapes amazing globe colorful exposure dof outdoor earth exploring country ngc newengland bluesky depthoffield explore exquisite capture majestic discovery powerful forests breathtaking capturing greatnature greatphotographers bestshotoftheday bestsky
More Storms Heading In