Latitude: 42.9561562
Longitude: -71.58806
Elevation: 176 meters / 577 feet
Barometric Pressure 992KPa

Related Photos

Looking for inspiration, manchester photography streetphotography man photographer bench river bridge monochrome inspiration nikon lines view allyouneedislight
Looking for inspiration
Picture Perfect Puddle,
Picture Perfect Puddle
Looking for beauty in the gray, river bridge drawins sun sky manchester newhampshire newengland merrimack
Looking for beauty in the gray
Big blue sky, blue sky barn farm horizon newengland newhampshire goffstown
Big blue sky
Manchester Monochrome,
Manchester Monochrome
Rocking and Rolling Along,
Rocking and Rolling Along
More M-B,
More M-B
NA-1 Working in Milford,
NA-1 Working in Milford
Pan Am or the Batten Kill?,
Pan Am or the Batten Kill?
first NX image, night manchester fireworks newhampshire sigma1224mmf4556dg nikoncapturenx
first NX image
NA-1 on the Hillsboro Branch,
NA-1 on the Hillsboro Branch
My favorite mistake, autumn fall leaves mistake naturesfinest d80 theperfectphotographer pmec
My favorite mistake
Quick snooze, reflection bird nature wildlife newhampshire waterbird nh goose amherst canadagoose d300 blueribbonwinner abigfave aplusphoto afsvrzoomnikkor70300mmf4556gifed avianexcellence naturewatcher pulpitpond
Quick snooze
Rheostats, amoskeag building engine dam gundersen hydro lake machine manchester newhampshire nh nikon places shots waterfront water old black gears infrastructure d5000 image picture interesting historical bobgundersen newengland engineering brown white gold catchycolors robertgundersen usa psnh photo nikond5000 inside interior power nikoncamera flickr eversourceenergy powerplant powerstation indoor generator electricity utility energy eversource hullstreetenergy ©bobgundersen dslr
Rheostats
Bull, macro spring frog bullfrog d300 afsvrmicronikkor105mmf28gifed goldstaraward
Bull
Zimmerman House, camera autumn house detail brick motif architecture square lens manchester us october exterior newengland newhampshire places historic franklloydwright architect residence usonian fllw usonianhouse usonia currierartmuseum ef1635mmf28liiusm curriermuseum canoneos5dmarkiii archdaily ©hassanbagheri ©hbarchitectural
Zimmerman House
World News Tonight @ Amoskeag dam, amoskeag dam gundersen lake livefreeordie manchester movie newhampshire nh night nightshots nikon places scenes shoreline shots town waterfront water hydro longexposure dark election black rock stone d5000 river image picture interesting winter ice bobgundersen newengland landscape robertgundersen people buoyant usa psnh photo nikond5000 nikoncamera flickr vote eversourceenergy outside outdoor generator electricity utility energy eversource hullstreetenergy ©bobgundersen dslr
World News Tonight @ Amoskeag dam
Firewater, autumn abstract reflection fall nature water leaves d300 afsdxvrzoomnikkor18200mmf3556gifed aplusphoto colourartaward pmec
Firewater
Reflecting On The M-B,
Reflecting On The M-B
Sunset over Uncanoonuc and MHT, sunset manchester airport mht manchesterboston regional londonderry new hampshire nh sky hammer skiinian ianhammer ihamr
Sunset over Uncanoonuc and MHT
Route 33 Bridge View, hipstamatic souhegan river nh milford factory mills app 5s iphone
Route 33 Bridge View
3rd Floor..., red urban black sign yellow photoshop manchester concrete grey exposure industrial adobephotoshop parkinggarage garage parking gray newhampshire nh stairwell line stairway urbanart adobe exit curb manchesternh hdr highdynamicrange exitsign lightroom industrialart 3xp photomatix tonemapped adobelightroom tonemap threeexposures manchesternewhampshire hutdog83 flickrhutch joshhutchins
3rd Floor...
Macblu, mcintyre ski area manchester new hampshire sky clouds horizon hills oak hill hammer skiinian ianhammer ihamr
Macblu
Piercing the Shadows on the Hillbilly,
Piercing the Shadows on the Hillbilly
Fireplace gas insert, Hearthstone Killington, fireplace fireplaceinsert
Fireplace gas insert, Hearthstone Killington
Taking in the horizon view with some refreshments on Thanksgiving., nub cigar ipa beer view western horizon smoke milford nh deck thanksgiving digesting dessert
Taking in the horizon view with some refreshments on Thanksgiving.
Manchester at Night, night manchester unitedstates newengland newhampshire clear
Manchester at Night
Fireplace insert ideas, fireplace fireplaceinsert
Fireplace insert ideas
Gas Fireplace Inserts, new autumn fireplace newengland burning your accessories manchesternh heating woodstove merrimacknh fireplaces keenenh vermontcastings woodstoves pelletstove gasfireplace stovewood hillsboroughnh bedfordnh fireplaceinsert gasfireplaces woodburningfireplace fireplaceinserts newenglandhome woodburningstoves gasstoves fireplacevillage allflame ventgasfireplace newhampshirefireplaces fireplaceventing homeheatingsolutions stoveswoodburning stovesnapoleonfireplacesfireplace constructionhome solutionsheat homefireplaces accessoriesfireplace jotulvermont chimneysinserts
Gas Fireplace Inserts
Jotul Katahdin Gas Fireplace Picture, new autumn fireplace newengland burning your accessories manchesternh heating woodstove merrimacknh fireplaces keenenh vermontcastings woodstoves pelletstove gasfireplace stovewood hillsboroughnh bedfordnh fireplaceinsert gasfireplaces woodburningfireplace fireplaceinserts newenglandhome woodburningstoves gasstoves fireplacevillage allflame ventgasfireplace newhampshirefireplaces fireplaceventing homeheatingsolutions stoveswoodburning stovesnapoleonfireplacesfireplace constructionhome solutionsheat homefireplaces accessoriesfireplace jotulvermont chimneysinserts
Jotul Katahdin Gas Fireplace Picture
Not the worst view ever from a hotel room... New Hampshire Fisher Cats Ballpark, newhampshire
Not the worst view ever from a hotel room... New Hampshire Fisher Cats Ballpark
View of Manchester, NH from Millyard, manchester solar construction newhampshire nh electricity psnh
View of Manchester, NH from Millyard
Snack, autumn fall nature newhampshire nh chipmunk blogged hancock d300 nhphototour aplusphoto afsvrzoomnikkor70300mmf4556gifed
Snack
Fireplace Insert Ideas, new autumn fireplace newengland burning your accessories manchesternh heating woodstove merrimacknh fireplaces keenenh vermontcastings woodstoves pelletstove gasfireplace stovewood hillsboroughnh bedfordnh fireplaceinsert gasfireplaces woodburningfireplace fireplaceinserts newenglandhome woodburningstoves gasstoves fireplacevillage allflame ventgasfireplace newhampshirefireplaces fireplaceventing homeheatingsolutions stoveswoodburning stovesnapoleonfireplacesfireplace constructionhome solutionsheat homefireplaces accessoriesfireplace jotulvermont chimneysinserts
Fireplace Insert Ideas
Napoleon Electric Fireplace, gasfireplace gasfireplaceinsert
Napoleon Electric Fireplace
Fireplace insert installation, fireplace fireplaceinsert fireplaceinserts
Fireplace insert installation
Hearthstone Maidstone Gas Fireplace Insert, new autumn fireplace newengland burning your accessories manchesternh heating woodstove merrimacknh fireplaces keenenh vermontcastings pelletstove gasfireplace stovewood hillsboroughnh bedfordnh fireplaceinsert gasfireplaces fireplaceinserts newenglandhome newhampshirefireplaces fireplaceinsertfireplacevillagedisplays fireplaceventing homeheatingsolutions stoveswoodburning stovesnapoleonfireplacesfireplace constructionhome solutionsheat homefireplaces accessoriesfireplace jotulvermont chimneysinserts
Hearthstone Maidstone Gas Fireplace Insert
Vent Gas Fireplaces for Homes, new autumn fireplace newengland burning your accessories manchesternh heating woodstove merrimacknh fireplaces keenenh vermontcastings woodstoves pelletstove gasfireplace stovewood hillsboroughnh bedfordnh fireplaceinsert gasfireplaces woodburningfireplace fireplaceinserts newenglandhome woodburningstoves gasstoves fireplacevillage allflame ventgasfireplace newhampshirefireplaces fireplaceventing homeheatingsolutions stoveswoodburning stovesnapoleonfireplacesfireplace constructionhome solutionsheat homefireplaces accessoriesfireplace jotulvermont chimneysinserts
Vent Gas Fireplaces for Homes
Fireplace Village, Wood Stove, Fireplace Gas Insert, Fireplace Glass Door, fireplace woodstove gasstove fireplaceinsert fireplaceglassdoor
Fireplace Village, Wood Stove, Fireplace Gas Insert, Fireplace Glass Door
_Z084765_hdr Joe English Rd New Boston NH (1),
_Z084765_hdr Joe English Rd New Boston NH (1)
Vermont Castings Resolute wood stove, new autumn fireplace newengland newhampshire burning your accessories manchesternh heating woodstove merrimacknh fireplaces keenenh vermontcastings pelletstove gasfireplace stovewood hillsboroughnh bedfordnh fireplaceinsert gasfireplaces fireplaceinserts newenglandhome fireplacevillage newhampshirefireplacesfireplacevillagedisplays fireplaceventing homeheatingsolutions stoveswoodburning stovesnapoleonfireplacesfireplace constructionhome solutionsheat homefireplaces accessoriesfireplace jotulvermont chimneysinserts
Vermont Castings Resolute wood stove
Wood Burning Fire Place Insert, new autumn fireplace newengland burning your accessories manchesternh heating woodstove merrimacknh fireplaces keenenh vermontcastings woodstoves pelletstove gasfireplace stovewood hillsboroughnh bedfordnh fireplaceinsert gasfireplaces woodburningfireplace fireplaceinserts newenglandhome woodburningstoves gasstoves fireplacevillage allflame ventgasfireplace newhampshirefireplaces fireplaceventing homeheatingsolutions stoveswoodburning stovesnapoleonfireplacesfireplace constructionhome solutionsheat homefireplaces accessoriesfireplace jotulvermont chimneysinserts
Wood Burning Fire Place Insert
Heat & Glo Gas Fireplaces, new autumn fireplace newengland burning your accessories manchesternh heating woodstove merrimacknh fireplaces keenenh vermontcastings woodstoves pelletstove gasfireplace stovewood hillsboroughnh bedfordnh fireplaceinsert gasfireplaces woodburningfireplace fireplaceinserts newenglandhome woodburningstoves gasstoves fireplacevillage allflame ventgasfireplace newhampshirefireplaces heatglo fireplaceventing homeheatingsolutions stoveswoodburning stovesnapoleonfireplacesfireplace constructionhome solutionsheat homefireplaces accessoriesfireplace jotulvermont chimneysinserts
Heat & Glo Gas Fireplaces
Heat & Glo Grand XT Gas Fireplace Insert Photo, new autumn fireplace newengland burning your accessories manchesternh heating woodstove merrimacknh fireplaces keenenh vermontcastings pelletstove gasfireplace stovewood hillsboroughnh bedfordnh fireplaceinsert gasfireplaces fireplaceinserts newenglandhome newhampshirefireplaces fireplaceinsertfireplacevillagedisplays fireplaceventing homeheatingsolutions stoveswoodburning stovesnapoleonfireplacesfireplace constructionhome solutionsheat homefireplaces accessoriesfireplace jotulvermont chimneysinserts
Heat & Glo Grand XT Gas Fireplace Insert Photo
Jotul Oslo Wood Stove, new autumn fireplace newengland burning your accessories manchesternh heating woodstove merrimacknh fireplaces keenenh vermontcastings woodstoves pelletstove gasfireplace stovewood jotul hillsboroughnh bedfordnh fireplaceinsert gasfireplaces woodburningfireplace fireplaceinserts newenglandhome woodburningstoves gasstoves fireplacevillage allflame ventgasfireplace newhampshirefireplaces fireplaceventing homeheatingsolutions stoveswoodburning stovesnapoleonfireplacesfireplace constructionhome solutionsheat homefireplaces accessoriesfireplace jotulvermont chimneysinserts
Jotul Oslo Wood Stove
View from Amoskeag Hydro Dam 2, amoskeaghydro electricity manchester nh psnh publicserviceofnewhampshire renewable energy generation eversourceenergy hullstreetenergy
View from Amoskeag Hydro Dam 2
Clouds on a cold and windy day., weatherphotos weatherphotography
Clouds on a cold and windy day.
Just a windy day..,
Just a windy day..
Twin Bridges Park, winter water newhampshire merrimack twinbridgespark
Twin Bridges Park
Concrete shelter, bridge bw monochrome photography thunder gray manchester river concrete shelter rain clouds downtown weather lines architecture blackwhitephotos columns nikon d5100 tokina longexposure heavy structure notredame landscape urban city life
Concrete shelter